PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529705.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 770aa    MW: 84437 Da    PI: 5.6058
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529705.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14.1e-085294347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
   XP_010529705.1 52 AWTHQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 94
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-104599IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-54797IPR009057Homeodomain-like
PROSITE profilePS5129313.524899IPR017884SANT domain
SMARTSM007175.1E-64997IPR001005SANT/Myb domain
CDDcd001671.27E-55295No hitNo description
PfamPF002493.3E-65294IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MQVEPQVLLN AASPLDQGPL LNQDGNPSFA ASTATNVVQL PGAKKPTRQW AAWTHQEEES  60
FFTALRQVGK NFEKITSRVQ SKNKDQVRHY YYRLVRRMNK LLGPELSLDA KNPKDTNAAM  120
LRWWSLLEKY SCKASKLHLK PRRFKLFIES LEHQLLKDRK KSIRKRVCQG ENFSAASLGS  180
FSNQSRERGV DNRSLKLILV DSQNIQKLGP GRASIIHSES LGISHGDEKE DIAASRGGRQ  240
RRKQAGLSSS PAYRRWEKAA INGVSLVADA AEHLERASID KNIDCRKDSG PSEHQSIGKS  300
LLSLGSSDHN PLNETNMQSA TKLKLQLFPI DECTRRALET GKHNPHLELT LSNRKKISSV  360
LEHLNRKWGN SSAASGDLML FPYSARKETV MSHQRWTQDS FLSAGDVHSM VGSPSVFRLR  420
YGWFIRSAWG SLTSQAPISA SCLQVEQDMN VDEVIGHVAE SAPLSLHSTA EPSRSLEPSQ  480
SVAGPSSEIL AHRAESRENL EQISASGPHN EKETGNMSSS DQIDNDDLHV GNDNALSAGE  540
WADSLTNISI GDLLSEAPGD LLSEAPDNID SDCADPQVED TECLLQDVPF ASDSFDAAIA  600
AHILRHHNEI GASLTLPSGS CLLWDDEETR DTFSFQNNRL ANASLSAVAS PVGTSKLNAE  660
PSHSVEGLPE PDLPSKSADL EDPMEEAPIE PNTADSPERT TLCGLADVYW PDSLGPLDLD  720
IRSSKYSNED LILSDSLGGL SRLIASSLDA FQNCSIFGSE NKSKDQPSMV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529705.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
RefseqXP_010529713.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
RefseqXP_010529721.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLD7LJ990.0D7LJ99_ARALL; Tsl-kinase interacting protein 1
STRINGscaffold_402323.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96332124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.30.0TSL-kinase interacting protein 1